Lineage for d1pf9d2 (1pf9 D:191-366)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. Protein GroEL, A domain [52031] (4 species)
  7. Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)
  8. Domain d1pf9d2: 1pf9 D:191-366 [94616]
    Other proteins in same PDB: d1pf9a1, d1pf9a3, d1pf9b1, d1pf9b3, d1pf9c1, d1pf9c3, d1pf9d1, d1pf9d3, d1pf9e1, d1pf9e3, d1pf9f1, d1pf9f3, d1pf9g1, d1pf9g3, d1pf9h1, d1pf9h3, d1pf9i1, d1pf9i3, d1pf9j1, d1pf9j3, d1pf9k1, d1pf9k3, d1pf9l1, d1pf9l3, d1pf9m1, d1pf9m3, d1pf9n1, d1pf9n3, d1pf9o_, d1pf9p_, d1pf9q_, d1pf9r_, d1pf9s_, d1pf9t_, d1pf9u_
    complexed with adp, mg

Details for d1pf9d2

PDB Entry: 1pf9 (more details), 2.99 Å

PDB Description: groel-groes-adp
PDB Compounds: (D:) groEL protein

SCOPe Domain Sequences for d1pf9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pf9d2 c.8.5.1 (D:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOPe Domain Coordinates for d1pf9d2 are not available.

Timeline for d1pf9d2: