Lineage for d1pf9a1 (1pf9 A:2-136,A:410-525)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. Protein GroEL, E domain [48594] (4 species)
  7. Species Escherichia coli [TaxId:562] [48595] (11 PDB entries)
  8. Domain d1pf9a1: 1pf9 A:2-136,A:410-525 [94606]
    Other proteins in same PDB: d1pf9a2, d1pf9a3, d1pf9b2, d1pf9b3, d1pf9c2, d1pf9c3, d1pf9d2, d1pf9d3, d1pf9e2, d1pf9e3, d1pf9f2, d1pf9f3, d1pf9g2, d1pf9g3, d1pf9h2, d1pf9h3, d1pf9i2, d1pf9i3, d1pf9j2, d1pf9j3, d1pf9k2, d1pf9k3, d1pf9l2, d1pf9l3, d1pf9m2, d1pf9m3, d1pf9n2, d1pf9n3, d1pf9o_, d1pf9p_, d1pf9q_, d1pf9r_, d1pf9s_, d1pf9t_, d1pf9u_
    complexed with adp, mg

Details for d1pf9a1

PDB Entry: 1pf9 (more details), 2.99 Å

PDB Description: groel-groes-adp
PDB Compounds: (A:) groEL protein

SCOPe Domain Sequences for d1pf9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pf9a1 a.129.1.1 (A:2-136,A:410-525) GroEL, E domain {Escherichia coli [TaxId: 562]}
aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtaaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

SCOPe Domain Coordinates for d1pf9a1 are not available.

Timeline for d1pf9a1: