Class b: All beta proteins [48724] (149 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (2 families) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries) |
Domain d1peza2: 1pez A:582-686 [94601] Other proteins in same PDB: d1peza1, d1peza3, d1peza4 complexed with acy, ca, epe, glc, mal, mpd; mutant |
PDB Entry: 1pez (more details), 2.32 Å
SCOP Domain Sequences for d1peza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1peza2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains} lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs vpagktiefkflkkqgstatweggsnhtftapssgtgtinvnwqp
Timeline for d1peza2: