Lineage for d1pcqn2 (1pcq N:191-366)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577176Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (9 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 577291Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 577292Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 577293Protein GroEL, A domain [52031] (4 species)
  7. 577294Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)
  8. 577354Domain d1pcqn2: 1pcq N:191-366 [94484]
    Other proteins in same PDB: d1pcqa1, d1pcqa3, d1pcqb1, d1pcqb3, d1pcqc1, d1pcqc3, d1pcqd1, d1pcqd3, d1pcqe1, d1pcqe3, d1pcqf1, d1pcqf3, d1pcqg1, d1pcqg3, d1pcqh1, d1pcqh3, d1pcqi1, d1pcqi3, d1pcqj1, d1pcqj3, d1pcqk1, d1pcqk3, d1pcql1, d1pcql3, d1pcqm1, d1pcqm3, d1pcqn1, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_
    complexed with adp, af3, k, mg

Details for d1pcqn2

PDB Entry: 1pcq (more details), 2.81 Å

PDB Description: Crystal structure of groEL-groES

SCOP Domain Sequences for d1pcqn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcqn2 c.8.5.1 (N:191-366) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1pcqn2:

Click to download the PDB-style file with coordinates for d1pcqn2.
(The format of our PDB-style files is described here.)

Timeline for d1pcqn2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pcqa1, d1pcqa2, d1pcqa3, d1pcqb1, d1pcqb2, d1pcqb3, d1pcqc1, d1pcqc2, d1pcqc3, d1pcqd1, d1pcqd2, d1pcqd3, d1pcqe1, d1pcqe2, d1pcqe3, d1pcqf1, d1pcqf2, d1pcqf3, d1pcqg1, d1pcqg2, d1pcqg3, d1pcqh1, d1pcqh2, d1pcqh3, d1pcqi1, d1pcqi2, d1pcqi3, d1pcqj1, d1pcqj2, d1pcqj3, d1pcqk1, d1pcqk2, d1pcqk3, d1pcql1, d1pcql2, d1pcql3, d1pcqm1, d1pcqm2, d1pcqm3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_