Lineage for d1pcqk3 (1pcq K:137-190,K:367-409)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503734Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 503735Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 503736Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 503737Protein GroEL, I domain [54851] (3 species)
  7. 503738Species Escherichia coli [TaxId:562] [54852] (9 PDB entries)
  8. 503812Domain d1pcqk3: 1pcq K:137-190,K:367-409 [94476]
    Other proteins in same PDB: d1pcqa1, d1pcqa2, d1pcqb1, d1pcqb2, d1pcqc1, d1pcqc2, d1pcqd1, d1pcqd2, d1pcqe1, d1pcqe2, d1pcqf1, d1pcqf2, d1pcqg1, d1pcqg2, d1pcqh1, d1pcqh2, d1pcqi1, d1pcqi2, d1pcqj1, d1pcqj2, d1pcqk1, d1pcqk2, d1pcql1, d1pcql2, d1pcqm1, d1pcqm2, d1pcqn1, d1pcqn2, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_

Details for d1pcqk3

PDB Entry: 1pcq (more details), 2.81 Å

PDB Description: Crystal structure of groEL-groES
PDB Compounds: (K:)

SCOP Domain Sequences for d1pcqk3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcqk3 d.56.1.1 (K:137-190,K:367-409) GroEL, I domain {Escherichia coli}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOP Domain Coordinates for d1pcqk3:

Click to download the PDB-style file with coordinates for d1pcqk3.
(The format of our PDB-style files is described here.)

Timeline for d1pcqk3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pcqa1, d1pcqa2, d1pcqa3, d1pcqb1, d1pcqb2, d1pcqb3, d1pcqc1, d1pcqc2, d1pcqc3, d1pcqd1, d1pcqd2, d1pcqd3, d1pcqe1, d1pcqe2, d1pcqe3, d1pcqf1, d1pcqf2, d1pcqf3, d1pcqg1, d1pcqg2, d1pcqg3, d1pcqh1, d1pcqh2, d1pcqh3, d1pcqi1, d1pcqi2, d1pcqi3, d1pcqj1, d1pcqj2, d1pcqj3, d1pcql1, d1pcql2, d1pcql3, d1pcqm1, d1pcqm2, d1pcqm3, d1pcqn1, d1pcqn2, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_