Lineage for d1pcqk1 (1pcq K:2-136,K:410-525)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015007Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 2015008Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 2015009Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 2015010Protein GroEL, E domain [48594] (4 species)
  7. 2015011Species Escherichia coli [TaxId:562] [48595] (11 PDB entries)
  8. 2015071Domain d1pcqk1: 1pcq K:2-136,K:410-525 [94474]
    Other proteins in same PDB: d1pcqa2, d1pcqa3, d1pcqb2, d1pcqb3, d1pcqc2, d1pcqc3, d1pcqd2, d1pcqd3, d1pcqe2, d1pcqe3, d1pcqf2, d1pcqf3, d1pcqg2, d1pcqg3, d1pcqh2, d1pcqh3, d1pcqi2, d1pcqi3, d1pcqj2, d1pcqj3, d1pcqk2, d1pcqk3, d1pcql2, d1pcql3, d1pcqm2, d1pcqm3, d1pcqn2, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_
    complexed with adp, af3, k, mg

Details for d1pcqk1

PDB Entry: 1pcq (more details), 2.81 Å

PDB Description: Crystal structure of groEL-groES
PDB Compounds: (K:) groEL protein

SCOPe Domain Sequences for d1pcqk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcqk1 a.129.1.1 (K:2-136,K:410-525) GroEL, E domain {Escherichia coli [TaxId: 562]}
aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtaaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

SCOPe Domain Coordinates for d1pcqk1:

Click to download the PDB-style file with coordinates for d1pcqk1.
(The format of our PDB-style files is described here.)

Timeline for d1pcqk1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pcqa1, d1pcqa2, d1pcqa3, d1pcqb1, d1pcqb2, d1pcqb3, d1pcqc1, d1pcqc2, d1pcqc3, d1pcqd1, d1pcqd2, d1pcqd3, d1pcqe1, d1pcqe2, d1pcqe3, d1pcqf1, d1pcqf2, d1pcqf3, d1pcqg1, d1pcqg2, d1pcqg3, d1pcqh1, d1pcqh2, d1pcqh3, d1pcqi1, d1pcqi2, d1pcqi3, d1pcqj1, d1pcqj2, d1pcqj3, d1pcql1, d1pcql2, d1pcql3, d1pcqm1, d1pcqm2, d1pcqm3, d1pcqn1, d1pcqn2, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_