Lineage for d1pcqi2 (1pcq I:191-366)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 479747Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 479858Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 479859Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 479860Protein GroEL, A domain [52031] (3 species)
  7. 479861Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)
  8. 479944Domain d1pcqi2: 1pcq I:191-366 [94469]
    Other proteins in same PDB: d1pcqa1, d1pcqa3, d1pcqb1, d1pcqb3, d1pcqc1, d1pcqc3, d1pcqd1, d1pcqd3, d1pcqe1, d1pcqe3, d1pcqf1, d1pcqf3, d1pcqg1, d1pcqg3, d1pcqh1, d1pcqh3, d1pcqi1, d1pcqi3, d1pcqj1, d1pcqj3, d1pcqk1, d1pcqk3, d1pcql1, d1pcql3, d1pcqm1, d1pcqm3, d1pcqn1, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_

Details for d1pcqi2

PDB Entry: 1pcq (more details), 2.81 Å

PDB Description: Crystal structure of groEL-groES
PDB Compounds: (I:)

SCOP Domain Sequences for d1pcqi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcqi2 c.8.5.1 (I:191-366) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1pcqi2:

Click to download the PDB-style file with coordinates for d1pcqi2.
(The format of our PDB-style files is described here.)

Timeline for d1pcqi2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pcqa1, d1pcqa2, d1pcqa3, d1pcqb1, d1pcqb2, d1pcqb3, d1pcqc1, d1pcqc2, d1pcqc3, d1pcqd1, d1pcqd2, d1pcqd3, d1pcqe1, d1pcqe2, d1pcqe3, d1pcqf1, d1pcqf2, d1pcqf3, d1pcqg1, d1pcqg2, d1pcqg3, d1pcqh1, d1pcqh2, d1pcqh3, d1pcqj1, d1pcqj2, d1pcqj3, d1pcqk1, d1pcqk2, d1pcqk3, d1pcql1, d1pcql2, d1pcql3, d1pcqm1, d1pcqm2, d1pcqm3, d1pcqn1, d1pcqn2, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_