Lineage for d1pcqe3 (1pcq E:137-190,E:367-409)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. Protein GroEL, I domain [54851] (4 species)
  7. Species Escherichia coli [TaxId:562] [54852] (11 PDB entries)
  8. Domain d1pcqe3: 1pcq E:137-190,E:367-409 [94458]
    Other proteins in same PDB: d1pcqa1, d1pcqa2, d1pcqb1, d1pcqb2, d1pcqc1, d1pcqc2, d1pcqd1, d1pcqd2, d1pcqe1, d1pcqe2, d1pcqf1, d1pcqf2, d1pcqg1, d1pcqg2, d1pcqh1, d1pcqh2, d1pcqi1, d1pcqi2, d1pcqj1, d1pcqj2, d1pcqk1, d1pcqk2, d1pcql1, d1pcql2, d1pcqm1, d1pcqm2, d1pcqn1, d1pcqn2, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_
    complexed with adp, af3, k, mg

Details for d1pcqe3

PDB Entry: 1pcq (more details), 2.81 Å

PDB Description: Crystal structure of groEL-groES
PDB Compounds: (E:) groEL protein

SCOPe Domain Sequences for d1pcqe3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcqe3 d.56.1.1 (E:137-190,E:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOPe Domain Coordinates for d1pcqe3 are not available.

Timeline for d1pcqe3: