Lineage for d1pcqd1 (1pcq D:2-136,D:410-525)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448721Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 448722Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 448723Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 448724Protein GroEL, E domain [48594] (3 species)
  7. 448725Species Escherichia coli [TaxId:562] [48595] (9 PDB entries)
  8. 448792Domain d1pcqd1: 1pcq D:2-136,D:410-525 [94453]
    Other proteins in same PDB: d1pcqa2, d1pcqa3, d1pcqb2, d1pcqb3, d1pcqc2, d1pcqc3, d1pcqd2, d1pcqd3, d1pcqe2, d1pcqe3, d1pcqf2, d1pcqf3, d1pcqg2, d1pcqg3, d1pcqh2, d1pcqh3, d1pcqi2, d1pcqi3, d1pcqj2, d1pcqj3, d1pcqk2, d1pcqk3, d1pcql2, d1pcql3, d1pcqm2, d1pcqm3, d1pcqn2, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_

Details for d1pcqd1

PDB Entry: 1pcq (more details), 2.81 Å

PDB Description: Crystal structure of groEL-groES
PDB Compounds: (D:)

SCOP Domain Sequences for d1pcqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcqd1 a.129.1.1 (D:2-136,D:410-525) GroEL, E domain {Escherichia coli}
aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtaaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

SCOP Domain Coordinates for d1pcqd1:

Click to download the PDB-style file with coordinates for d1pcqd1.
(The format of our PDB-style files is described here.)

Timeline for d1pcqd1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pcqa1, d1pcqa2, d1pcqa3, d1pcqb1, d1pcqb2, d1pcqb3, d1pcqc1, d1pcqc2, d1pcqc3, d1pcqe1, d1pcqe2, d1pcqe3, d1pcqf1, d1pcqf2, d1pcqf3, d1pcqg1, d1pcqg2, d1pcqg3, d1pcqh1, d1pcqh2, d1pcqh3, d1pcqi1, d1pcqi2, d1pcqi3, d1pcqj1, d1pcqj2, d1pcqj3, d1pcqk1, d1pcqk2, d1pcqk3, d1pcql1, d1pcql2, d1pcql3, d1pcqm1, d1pcqm2, d1pcqm3, d1pcqn1, d1pcqn2, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_