Lineage for d1pcqb3 (1pcq B:137-190,B:367-409)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723181Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 723182Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 723183Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 723184Protein GroEL, I domain [54851] (4 species)
  7. 723185Species Escherichia coli [TaxId:562] [54852] (9 PDB entries)
  8. 723208Domain d1pcqb3: 1pcq B:137-190,B:367-409 [94449]
    Other proteins in same PDB: d1pcqa1, d1pcqa2, d1pcqb1, d1pcqb2, d1pcqc1, d1pcqc2, d1pcqd1, d1pcqd2, d1pcqe1, d1pcqe2, d1pcqf1, d1pcqf2, d1pcqg1, d1pcqg2, d1pcqh1, d1pcqh2, d1pcqi1, d1pcqi2, d1pcqj1, d1pcqj2, d1pcqk1, d1pcqk2, d1pcql1, d1pcql2, d1pcqm1, d1pcqm2, d1pcqn1, d1pcqn2, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_

Details for d1pcqb3

PDB Entry: 1pcq (more details), 2.81 Å

PDB Description: Crystal structure of groEL-groES
PDB Compounds: (B:) groEL protein

SCOP Domain Sequences for d1pcqb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcqb3 d.56.1.1 (B:137-190,B:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOP Domain Coordinates for d1pcqb3:

Click to download the PDB-style file with coordinates for d1pcqb3.
(The format of our PDB-style files is described here.)

Timeline for d1pcqb3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pcqa1, d1pcqa2, d1pcqa3, d1pcqc1, d1pcqc2, d1pcqc3, d1pcqd1, d1pcqd2, d1pcqd3, d1pcqe1, d1pcqe2, d1pcqe3, d1pcqf1, d1pcqf2, d1pcqf3, d1pcqg1, d1pcqg2, d1pcqg3, d1pcqh1, d1pcqh2, d1pcqh3, d1pcqi1, d1pcqi2, d1pcqi3, d1pcqj1, d1pcqj2, d1pcqj3, d1pcqk1, d1pcqk2, d1pcqk3, d1pcql1, d1pcql2, d1pcql3, d1pcqm1, d1pcqm2, d1pcqm3, d1pcqn1, d1pcqn2, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_