Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (9 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) |
Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein) |
Protein GroEL, A domain [52031] (4 species) |
Species Escherichia coli [TaxId:562] [52032] (16 PDB entries) |
Domain d1pcqb2: 1pcq B:191-366 [94448] Other proteins in same PDB: d1pcqa1, d1pcqa3, d1pcqb1, d1pcqb3, d1pcqc1, d1pcqc3, d1pcqd1, d1pcqd3, d1pcqe1, d1pcqe3, d1pcqf1, d1pcqf3, d1pcqg1, d1pcqg3, d1pcqh1, d1pcqh3, d1pcqi1, d1pcqi3, d1pcqj1, d1pcqj3, d1pcqk1, d1pcqk3, d1pcql1, d1pcql3, d1pcqm1, d1pcqm3, d1pcqn1, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_ |
PDB Entry: 1pcq (more details), 2.81 Å
SCOP Domain Sequences for d1pcqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pcqb2 c.8.5.1 (B:191-366) GroEL, A domain {Escherichia coli} egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq
Timeline for d1pcqb2:
View in 3D Domains from other chains: (mouse over for more information) d1pcqa1, d1pcqa2, d1pcqa3, d1pcqc1, d1pcqc2, d1pcqc3, d1pcqd1, d1pcqd2, d1pcqd3, d1pcqe1, d1pcqe2, d1pcqe3, d1pcqf1, d1pcqf2, d1pcqf3, d1pcqg1, d1pcqg2, d1pcqg3, d1pcqh1, d1pcqh2, d1pcqh3, d1pcqi1, d1pcqi2, d1pcqi3, d1pcqj1, d1pcqj2, d1pcqj3, d1pcqk1, d1pcqk2, d1pcqk3, d1pcql1, d1pcql2, d1pcql3, d1pcqm1, d1pcqm2, d1pcqm3, d1pcqn1, d1pcqn2, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_ |