Lineage for d1pcqb1 (1pcq B:2-136,B:410-525)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. Protein GroEL, E domain [48594] (4 species)
  7. Species Escherichia coli [TaxId:562] [48595] (11 PDB entries)
  8. Domain d1pcqb1: 1pcq B:2-136,B:410-525 [94447]
    Other proteins in same PDB: d1pcqa2, d1pcqa3, d1pcqb2, d1pcqb3, d1pcqc2, d1pcqc3, d1pcqd2, d1pcqd3, d1pcqe2, d1pcqe3, d1pcqf2, d1pcqf3, d1pcqg2, d1pcqg3, d1pcqh2, d1pcqh3, d1pcqi2, d1pcqi3, d1pcqj2, d1pcqj3, d1pcqk2, d1pcqk3, d1pcql2, d1pcql3, d1pcqm2, d1pcqm3, d1pcqn2, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_
    complexed with adp, af3, k, mg

Details for d1pcqb1

PDB Entry: 1pcq (more details), 2.81 Å

PDB Description: Crystal structure of groEL-groES
PDB Compounds: (B:) groEL protein

SCOPe Domain Sequences for d1pcqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcqb1 a.129.1.1 (B:2-136,B:410-525) GroEL, E domain {Escherichia coli [TaxId: 562]}
aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtaaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

SCOPe Domain Coordinates for d1pcqb1 are not available.

Timeline for d1pcqb1: