Lineage for d1pcqa3 (1pcq A:137-190,A:367-409)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503734Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 503735Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 503736Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 503737Protein GroEL, I domain [54851] (3 species)
  7. 503738Species Escherichia coli [TaxId:562] [54852] (9 PDB entries)
  8. 503802Domain d1pcqa3: 1pcq A:137-190,A:367-409 [94446]
    Other proteins in same PDB: d1pcqa1, d1pcqa2, d1pcqb1, d1pcqb2, d1pcqc1, d1pcqc2, d1pcqd1, d1pcqd2, d1pcqe1, d1pcqe2, d1pcqf1, d1pcqf2, d1pcqg1, d1pcqg2, d1pcqh1, d1pcqh2, d1pcqi1, d1pcqi2, d1pcqj1, d1pcqj2, d1pcqk1, d1pcqk2, d1pcql1, d1pcql2, d1pcqm1, d1pcqm2, d1pcqn1, d1pcqn2, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_

Details for d1pcqa3

PDB Entry: 1pcq (more details), 2.81 Å

PDB Description: Crystal structure of groEL-groES

SCOP Domain Sequences for d1pcqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcqa3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Escherichia coli}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOP Domain Coordinates for d1pcqa3:

Click to download the PDB-style file with coordinates for d1pcqa3.
(The format of our PDB-style files is described here.)

Timeline for d1pcqa3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pcqb1, d1pcqb2, d1pcqb3, d1pcqc1, d1pcqc2, d1pcqc3, d1pcqd1, d1pcqd2, d1pcqd3, d1pcqe1, d1pcqe2, d1pcqe3, d1pcqf1, d1pcqf2, d1pcqf3, d1pcqg1, d1pcqg2, d1pcqg3, d1pcqh1, d1pcqh2, d1pcqh3, d1pcqi1, d1pcqi2, d1pcqi3, d1pcqj1, d1pcqj2, d1pcqj3, d1pcqk1, d1pcqk2, d1pcqk3, d1pcql1, d1pcql2, d1pcql3, d1pcqm1, d1pcqm2, d1pcqm3, d1pcqn1, d1pcqn2, d1pcqn3, d1pcqo_, d1pcqp_, d1pcqq_, d1pcqr_, d1pcqs_, d1pcqt_, d1pcqu_