Lineage for d1pc2a1 (1pc2 A:1-145)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726650Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2726727Protein Mitochondria fission protein Fis1 [101417] (2 species)
  7. 2726733Species Human (Homo sapiens) [TaxId:9606] [101418] (2 PDB entries)
  8. 2726735Domain d1pc2a1: 1pc2 A:1-145 [94427]
    Other proteins in same PDB: d1pc2a2

Details for d1pc2a1

PDB Entry: 1pc2 (more details)

PDB Description: solution structure of human mitochondria fission protein fis1
PDB Compounds: (A:) mitochondria fission protein

SCOPe Domain Sequences for d1pc2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pc2a1 a.118.8.1 (A:1-145) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}
meavlnelvsvedllkfekkfqsekaagsvskstqfeyawclvrskynddirkgivllee
llpkgskeeqrdyvfylavgnyrlkeyekalkyvrgllqtepqnnqakelerlidkamkk
dglvgmaivggmalgvaglagligl

SCOPe Domain Coordinates for d1pc2a1:

Click to download the PDB-style file with coordinates for d1pc2a1.
(The format of our PDB-style files is described here.)

Timeline for d1pc2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pc2a2