Lineage for d1pbyc_ (1pby C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733906Superfamily a.137.9: Quinohemoprotein amine dehydrogenase C chain [69131] (1 family) (S)
    automatically mapped to Pfam PF08992
  5. 2733907Family a.137.9.1: Quinohemoprotein amine dehydrogenase C chain [69132] (1 protein)
  6. 2733908Protein Quinohemoprotein amine dehydrogenase C chain [69133] (2 species)
  7. 2733909Species Paracoccus denitrificans [TaxId:266] [69134] (2 PDB entries)
  8. 2733910Domain d1pbyc_: 1pby C: [94423]
    Other proteins in same PDB: d1pbya1, d1pbya2, d1pbya3, d1pbya4, d1pbya5, d1pbyb_
    complexed with hec, tbu

Details for d1pbyc_

PDB Entry: 1pby (more details), 1.7 Å

PDB Description: structure of the phenylhydrazine adduct of the quinohemoprotein amine dehydrogenase from paracoccus denitrificans at 1.7 a resolution
PDB Compounds: (C:) quinohemoprotein amine dehydrogenase 9 kDa subunit

SCOPe Domain Sequences for d1pbyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbyc_ a.137.9.1 (C:) Quinohemoprotein amine dehydrogenase C chain {Paracoccus denitrificans [TaxId: 266]}
mnalvgcttsfdpgwevdafgavsnlcqpmeadlygcadpcwwpaqvadtlntypnwsag
addvmqdwrklqsvfpetk

SCOPe Domain Coordinates for d1pbyc_:

Click to download the PDB-style file with coordinates for d1pbyc_.
(The format of our PDB-style files is described here.)

Timeline for d1pbyc_: