Lineage for d1pbya4 (1pby A:352-489)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789585Family b.1.18.14: Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [81294] (1 protein)
  6. 789586Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species)
    duplication: tandem repeat of two Ig-like domains
  7. 789587Species Paracoccus denitrificans [TaxId:266] [69177] (2 PDB entries)
  8. 789589Domain d1pbya4: 1pby A:352-489 [94420]
    Other proteins in same PDB: d1pbya1, d1pbya2, d1pbya5, d1pbyb_, d1pbyc_
    complexed with hem, tbu, trw

Details for d1pbya4

PDB Entry: 1pby (more details), 1.7 Å

PDB Description: structure of the phenylhydrazine adduct of the quinohemoprotein amine dehydrogenase from paracoccus denitrificans at 1.7 a resolution
PDB Compounds: (A:) quinohemoprotein amine dehydrogenase 60 kDa subunit

SCOP Domain Sequences for d1pbya4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbya4 b.1.18.14 (A:352-489) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Paracoccus denitrificans [TaxId: 266]}
rpdrisivpdltiariggnggpipkvpaqfeamgwlngpdgqpgtgddialgafpaswat
dnfdeeaekmqdakyagsiddtglftpaeagpnperpmqtnnagnlkviatvdaegepls
aeahlyatvqrfvdapir

SCOP Domain Coordinates for d1pbya4:

Click to download the PDB-style file with coordinates for d1pbya4.
(The format of our PDB-style files is described here.)

Timeline for d1pbya4: