| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (23 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.14: Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [81294] (1 protein) |
| Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species) duplication: tandem repeat of two Ig-like domains |
| Species Paracoccus denitrificans [TaxId:266] [69177] (2 PDB entries) |
| Domain d1pbya4: 1pby A:352-489 [94420] Other proteins in same PDB: d1pbya1, d1pbya2, d1pbya5, d1pbyb_, d1pbyc_ complexed with hem, tbu, trw |
PDB Entry: 1pby (more details), 1.7 Å
SCOP Domain Sequences for d1pbya4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pbya4 b.1.18.14 (A:352-489) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Paracoccus denitrificans [TaxId: 266]}
rpdrisivpdltiariggnggpipkvpaqfeamgwlngpdgqpgtgddialgafpaswat
dnfdeeaekmqdakyagsiddtglftpaeagpnperpmqtnnagnlkviatvdaegepls
aeahlyatvqrfvdapir
Timeline for d1pbya4:
View in 3DDomains from same chain: (mouse over for more information) d1pbya1, d1pbya2, d1pbya3, d1pbya5 |