![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
![]() | Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) ![]() common motif in otherwise different folds |
![]() | Family d.66.1.6: YbcJ-like [103046] (1 protein) overall topological similarity to the TyrRS C-domain |
![]() | Protein Hypothetical protein YbcJ [103047] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [103048] (1 PDB entry) |
![]() | Domain d1p9ka_: 1p9k A: [94392] |
PDB Entry: 1p9k (more details)
SCOP Domain Sequences for d1p9ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p9ka_ d.66.1.6 (A:) Hypothetical protein YbcJ {Escherichia coli [TaxId: 562]} gsmihrmsnmatfslgkhphvelcdllklegwsesgaqakiaiaegqvkvdgavetrkrc kivagqtvsfaghsvqvva
Timeline for d1p9ka_: