Class g: Small proteins [56992] (72 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (6 families) |
Family g.3.11.1: EGF-type module [57197] (21 proteins) |
Protein Epidermal growth factor, EGF [57215] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [69939] (4 PDB entries) |
Domain d1p9ja_: 1p9j A: [94391] EGF/TGFalpha chimera |
PDB Entry: 1p9j (more details)
SCOP Domain Sequences for d1p9ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p9ja_ g.3.11.1 (A:) Epidermal growth factor, EGF {Human (Homo sapiens)} vvshfndcplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwel
Timeline for d1p9ja_: