Lineage for d1p9ja_ (1p9j A:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 427258Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 427874Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 427875Family g.3.11.1: EGF-type module [57197] (21 proteins)
  6. 427926Protein Epidermal growth factor, EGF [57215] (2 species)
  7. 427927Species Human (Homo sapiens) [TaxId:9606] [69939] (4 PDB entries)
  8. 427933Domain d1p9ja_: 1p9j A: [94391]
    EGF/TGFalpha chimera

Details for d1p9ja_

PDB Entry: 1p9j (more details)

PDB Description: solution structure and dynamics of the egf/tgf-alpha chimera t1e

SCOP Domain Sequences for d1p9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9ja_ g.3.11.1 (A:) Epidermal growth factor, EGF {Human (Homo sapiens)}
vvshfndcplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwel

SCOP Domain Coordinates for d1p9ja_:

Click to download the PDB-style file with coordinates for d1p9ja_.
(The format of our PDB-style files is described here.)

Timeline for d1p9ja_: