Lineage for d1p9du_ (1p9d U:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1892546Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1893199Protein Ubiquitin-like domain of Rad23 homolog A (Hhr23a) [102775] (1 species)
  7. 1893200Species Human (Homo sapiens) [TaxId:9606] [102776] (4 PDB entries)
  8. 1893203Domain d1p9du_: 1p9d U: [94388]
    Other proteins in same PDB: d1p9ds_
    complexed with the C-terminal ubiquitin-interacting motif of the proteasome subunit s5a

Details for d1p9du_

PDB Entry: 1p9d (more details)

PDB Description: High-resolution structure of the complex of HHR23A ubiquitin-like domain and the C-terminal ubiquitin-interacting motif of proteasome subunit S5a
PDB Compounds: (U:) uv excision repair protein rad23 homolog a

SCOPe Domain Sequences for d1p9du_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9du_ d.15.1.1 (U:) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]}
mavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp
irdyrideknfvvvmvtk

SCOPe Domain Coordinates for d1p9du_:

Click to download the PDB-style file with coordinates for d1p9du_.
(The format of our PDB-style files is described here.)

Timeline for d1p9du_: