![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin-like domain of Rad23 homolog A (Hhr23a) [102775] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102776] (4 PDB entries) |
![]() | Domain d1p9du_: 1p9d U: [94388] Other proteins in same PDB: d1p9ds_ complexed with the C-terminal ubiquitin-interacting motif of the proteasome subunit s5a |
PDB Entry: 1p9d (more details)
SCOPe Domain Sequences for d1p9du_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p9du_ d.15.1.1 (U:) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} mavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp irdyrideknfvvvmvtk
Timeline for d1p9du_: