Lineage for d1p90a_ (1p90 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2495539Superfamily c.55.5: Nitrogenase accessory factor-like [53146] (3 families) (S)
  5. 2495551Family c.55.5.2: Nitrogenase accessory factor [102496] (1 protein)
    capable of binding the iron molybdenum cofactor, FeMo-co
  6. 2495552Protein NafY core domain [102497] (1 species)
  7. 2495553Species Azotobacter vinelandii [TaxId:354] [102498] (1 PDB entry)
  8. 2495554Domain d1p90a_: 1p90 A: [94377]
    complexed with edo

Details for d1p90a_

PDB Entry: 1p90 (more details), 1.8 Å

PDB Description: The Three-dimensional Structure of the Core Domain of NafY from Azotobacter vinelandii determined at 1.8 resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1p90a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p90a_ c.55.5.2 (A:) NafY core domain {Azotobacter vinelandii [TaxId: 354]}
ervpegsirvaiasnngeqldghfgsclrflvyqvsakdaslvdirstldvalaedknaw
rveqiqdcqvlyvvsiggpaaakvvragihplkkpkgcaaqeaiaelqtvmagspppwla
klv

SCOPe Domain Coordinates for d1p90a_:

Click to download the PDB-style file with coordinates for d1p90a_.
(The format of our PDB-style files is described here.)

Timeline for d1p90a_: