![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.5: Nitrogenase accessory factor-like [53146] (3 families) ![]() |
![]() | Family c.55.5.2: Nitrogenase accessory factor [102496] (1 protein) capable of binding the iron molybdenum cofactor, FeMo-co |
![]() | Protein NafY core domain [102497] (1 species) |
![]() | Species Azotobacter vinelandii [TaxId:354] [102498] (1 PDB entry) |
![]() | Domain d1p90a_: 1p90 A: [94377] complexed with edo |
PDB Entry: 1p90 (more details), 1.8 Å
SCOPe Domain Sequences for d1p90a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p90a_ c.55.5.2 (A:) NafY core domain {Azotobacter vinelandii [TaxId: 354]} ervpegsirvaiasnngeqldghfgsclrflvyqvsakdaslvdirstldvalaedknaw rveqiqdcqvlyvvsiggpaaakvvragihplkkpkgcaaqeaiaelqtvmagspppwla klv
Timeline for d1p90a_: