SCOP 1.75: Domain d1p8za2: 1p8z A:147-370

Lineage for d1p8za2 (1p8z A:147-370)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (20 PDB entries)
   Uniprot P02568
   SQ 02568
   Uniprot P02568 ! SQ 02568

8. Domain d1p8za2: 1p8z A:147-370 [94375]
   Other proteins in same PDB: d1p8zg_
   complexed with atp, ca, cd

Details for d1p8za2

PDB Entry: 1p8z, 2.6 Å

PDB Description: Complex Between Rabbit Muscle alpha-Actin: Human Gelsolin Residues Val26-Glu156

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOP Domain Sequences for d1p8za2:

Sequence; same for both SEQRES and ATOM records:

>d1p8za2 c.55.1.1 (A:147-370) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsiv

Timeline for d1p8za2:

• d1p8za2 first appeared in SCOP 1.67
  
• d1p8za2 appears in SCOP 1.73
  
• d1p8za2 appears in SCOPe 2.01
  
• d1p8za2 appears in the current release, SCOPe 2.08