Lineage for d1p8la2 (1p8l A:2-189)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418907Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 419108Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (4 families) (S)
    has a circularly permuted topology
  5. 419109Family d.142.2.1: ATP-dependent DNA ligase, N-terminal domain [56092] (1 protein)
  6. 419110Protein ATP-dependent DNA ligase, N-terminal domain [56093] (2 species)
  7. 419113Species Chlorella virus, PBCV-1 [56095] (2 PDB entries)
  8. 419115Domain d1p8la2: 1p8l A:2-189 [94364]
    Other proteins in same PDB: d1p8la1
    complexed with amp

Details for d1p8la2

PDB Entry: 1p8l (more details), 2.95 Å

PDB Description: New Crystal Structure of Chlorella Virus DNA Ligase-Adenylate

SCOP Domain Sequences for d1p8la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8la2 d.142.2.1 (A:2-189) ATP-dependent DNA ligase, N-terminal domain {Chlorella virus, PBCV-1}
aitkpllaatleniedvqfpclatpkidgirsvkqtqmlsrtfkpirnsvmnrlltellp
egsdgeisiegatfqdttsavmtghkmynakfsyywfdyvtddplkkyidrvedmknyit
vhphilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlke
gillkmkq

SCOP Domain Coordinates for d1p8la2:

Click to download the PDB-style file with coordinates for d1p8la2.
(The format of our PDB-style files is described here.)

Timeline for d1p8la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p8la1