Lineage for d1p8la1 (1p8l A:190-297)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) 
Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins) Protein ATP-dependent DNA ligase [50310] (2 species) Species Chlorella virus PBCV-1 [TaxId:10506] [50312] (4 PDB entries) 
Domain d1p8la1: 1p8l A:190-297 [94363]
Other proteins in same PDB: d1p8la2
complexed with amp
Details for d1p8la1
PDB Entry: 1p8l (more details), 2.95 Å
PDB Description: New Crystal Structure of Chlorella Virus DNA Ligase-Adenylate
PDB Compounds: (A:) PBCV-1 DNA ligaseSCOPe Domain Sequences for d1p8la1:
Sequence, based on SEQRES records: (download)
>d1p8la1 b.40.4.6 (A:190-297) ATP-dependent DNA ligase {Chlorella virus PBCV-1 [TaxId: 10506]}
fkdaeatiismtalfkntntktkdnfgyskrsthksgkveedvmgsievdydgvvfsigt
gfdadqrrdfwqnkesyigkmvkfkyfemgskdcprfpvfigirheed
Sequence, based on observed residues (ATOM records): (download)
>d1p8la1 b.40.4.6 (A:190-297) ATP-dependent DNA ligase {Chlorella virus PBCV-1 [TaxId: 10506]}
fkdaeatiismtalfknfgyedvmgsievdydgvvfsigtgfdadqrrdfwqnkesyigk
mvkfkyfemgskdcprfpvfigirheed
SCOPe Domain Coordinates for d1p8la1:
Click to download the PDB-style file with coordinates for d1p8la1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1p8la1:
- d1p8la1 first appeared in SCOP 1.67
- d1p8la1 appears in SCOPe 2.07
View in 3D
