Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) |
Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
Protein Copper chaperone [55017] (3 species) |
Species Bacillus subtilis, CopZ [TaxId:1423] [69736] (2 PDB entries) |
Domain d1p8ga1: 1p8g A:1-69 [94360] Other proteins in same PDB: d1p8ga2 |
PDB Entry: 1p8g (more details)
SCOPe Domain Sequences for d1p8ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p8ga1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} meqktlqvegmscqhcvkavetsvgeldgvsavhvnleagkvdvsfdadkvsvkdiadai edqgydvak
Timeline for d1p8ga1: