Lineage for d1p7qd2 (1p7q D:98-198)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 935313Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 935562Protein Ligand binding domain of lir-1 (ilt2) [49206] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 935563Species Human (Homo sapiens) [TaxId:9606] [49207] (5 PDB entries)
    Uniprot Q8NHL6 25-218
  8. 935575Domain d1p7qd2: 1p7q D:98-198 [94316]
    Other proteins in same PDB: d1p7qa1, d1p7qa2, d1p7qb_

Details for d1p7qd2

PDB Entry: 1p7q (more details), 3.4 Å

PDB Description: Crystal Structure of HLA-A2 Bound to LIR-1, a Host and Viral MHC Receptor
PDB Compounds: (D:) leukocyte immunoglobulin-like receptor 1

SCOPe Domain Sequences for d1p7qd2:

Sequence, based on SEQRES records: (download)

>d1p7qd2 b.1.1.4 (D:98-198) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
ayikptlsaqpspvvnsggnvtlqcdsqvafdgfilckegedehpqclnsqphargssra
ifsvgpvspsrrwwyrcyaydsnspyewslpsdllellvlg

Sequence, based on observed residues (ATOM records): (download)

>d1p7qd2 b.1.1.4 (D:98-198) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
ayikptlsaqpspvvnsggnvtlqcdsqvafdgfilckegehpqclnsqphargssraif
svgpvspsrrwwyrcyaydsnspyewslpsdllellvlg

SCOPe Domain Coordinates for d1p7qd2:

Click to download the PDB-style file with coordinates for d1p7qd2.
(The format of our PDB-style files is described here.)

Timeline for d1p7qd2: