Lineage for d1p7lc1 (1p7l C:1-102)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511189Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 511190Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) (S)
  5. 511191Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 511192Protein S-adenosylmethionine synthetase [55975] (2 species)
    synonym: methionine adenosyltransferase, MAT
  7. 511193Species Escherichia coli [TaxId:562] [55976] (9 PDB entries)
  8. 511218Domain d1p7lc1: 1p7l C:1-102 [94301]

Details for d1p7lc1

PDB Entry: 1p7l (more details), 2.5 Å

PDB Description: s-adenosylmethionine synthetase complexed with amppnp and met.

SCOP Domain Sequences for d1p7lc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7lc1 d.130.1.1 (C:1-102) S-adenosylmethionine synthetase {Escherichia coli}
akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdi

SCOP Domain Coordinates for d1p7lc1:

Click to download the PDB-style file with coordinates for d1p7lc1.
(The format of our PDB-style files is described here.)

Timeline for d1p7lc1: