Lineage for d1p7lb3 (1p7l B:232-383)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418475Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 418476Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) (S)
  5. 418477Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 418478Protein S-adenosylmethionine synthetase [55975] (2 species)
    synonym: methionine adenosyltransferase, MAT
  7. 418479Species Escherichia coli [TaxId:562] [55976] (9 PDB entries)
  8. 418503Domain d1p7lb3: 1p7l B:232-383 [94300]

Details for d1p7lb3

PDB Entry: 1p7l (more details), 2.5 Å

PDB Description: s-adenosylmethionine synthetase complexed with amppnp and met.

SCOP Domain Sequences for d1p7lb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7lb3 d.130.1.1 (B:232-383) S-adenosylmethionine synthetase {Escherichia coli}
iggpmgdcgltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagla
drceiqvsyaigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiy
ketaayghfgrehfpwektdkaqllrdaaglk

SCOP Domain Coordinates for d1p7lb3:

Click to download the PDB-style file with coordinates for d1p7lb3.
(The format of our PDB-style files is described here.)

Timeline for d1p7lb3: