![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
![]() | Domain d1p7kl2: 1p7k L:108-213 [94294] Other proteins in same PDB: d1p7ka1, d1p7kb1, d1p7kb2, d1p7kh1, d1p7kh2, d1p7kl1 |
PDB Entry: 1p7k (more details), 1.75 Å
SCOP Domain Sequences for d1p7kl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p7kl2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d1p7kl2: