SCOP 1.71: Domain d1p7kl2: 1p7k L:108-213

Lineage for d1p7kl2 (1p7k L:108-213)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)
Domain d1p7kl2: 1p7k L:108-213 [94294]
Other proteins in same PDB: d1p7ka1, d1p7kb1, d1p7kb2, d1p7kh1, d1p7kh2, d1p7kl1

Details for d1p7kl2

PDB Entry: 1p7k (more details), 1.75 Å

PDB Description: Crystal structure of an anti-ssDNA antigen-binding fragment (Fab) bound to 4-(2-Hydroxyethyl)piperazine-1-ethanesulfonic acid (HEPES)

SCOP Domain Sequences for d1p7kl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7kl2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOP Domain Coordinates for d1p7kl2:

Click to download the PDB-style file with coordinates for d1p7kl2.
(The format of our PDB-style files is described here.)

Timeline for d1p7kl2: