Lineage for d1p7kh2 (1p7k H:114-215)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655363Domain d1p7kh2: 1p7k H:114-215 [94292]
    Other proteins in same PDB: d1p7ka1, d1p7ka2, d1p7kb1, d1p7kh1, d1p7kl1, d1p7kl2

Details for d1p7kh2

PDB Entry: 1p7k (more details), 1.75 Å

PDB Description: Crystal structure of an anti-ssDNA antigen-binding fragment (Fab) bound to 4-(2-Hydroxyethyl)piperazine-1-ethanesulfonic acid (HEPES)
PDB Compounds: (H:) antibody heavy chain fab

SCOP Domain Sequences for d1p7kh2:

Sequence, based on SEQRES records: (download)

>d1p7kh2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Sequence, based on observed residues (ATOM records): (download)

>d1p7kh2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaansmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1p7kh2:

Click to download the PDB-style file with coordinates for d1p7kh2.
(The format of our PDB-style files is described here.)

Timeline for d1p7kh2: