SCOP 1.69: Domain d1p7kh2: 1p7k H:114-215

Lineage for d1p7kh2 (1p7k H:114-215)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)

8. Domain d1p7kh2: 1p7k H:114-215 [94292]
   Other proteins in same PDB: d1p7ka1, d1p7ka2, d1p7kb1, d1p7kh1, d1p7kl1, d1p7kl2

Details for d1p7kh2

PDB Entry: 1p7k, 1.75 Å

PDB Description: Crystal structure of an anti-ssDNA antigen-binding fragment (Fab) bound to 4-(2-Hydroxyethyl)piperazine-1-ethanesulfonic acid (HEPES)

SCOP Domain Sequences for d1p7kh2:

Sequence, based on SEQRES records:

>d1p7kh2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Sequence, based on observed residues (ATOM records):

>d1p7kh2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaansmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Timeline for d1p7kh2:

• d1p7kh2 first appeared in SCOP 1.67
  
• d1p7kh2 appears in SCOP 1.71
  
• d1p7kh2 appears in the current release, SCOPe 2.08