Lineage for d1p7ia_ (1p7i A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691791Protein Engrailed Homeodomain [46691] (1 species)
  7. 2691792Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries)
  8. 2691793Domain d1p7ia_: 1p7i A: [94279]
    complexed with nhe; mutant

Details for d1p7ia_

PDB Entry: 1p7i (more details), 2.1 Å

PDB Description: crystal structure of engrailed homeodomain mutant k52a
PDB Compounds: (A:) Segmentation polarity homeobox protein engrailed

SCOPe Domain Sequences for d1p7ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnarak

SCOPe Domain Coordinates for d1p7ia_:

Click to download the PDB-style file with coordinates for d1p7ia_.
(The format of our PDB-style files is described here.)

Timeline for d1p7ia_: