Lineage for d1p7ge1 (1p7g E:13-103)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690050Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 2690078Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)
  7. 2690132Species Pyrobaculum aerophilum [TaxId:13773] [100984] (2 PDB entries)
  8. 2690137Domain d1p7ge1: 1p7g E:13-103 [94231]
    Other proteins in same PDB: d1p7ga2, d1p7ga3, d1p7gb2, d1p7gb3, d1p7gc2, d1p7gc3, d1p7gd2, d1p7gd3, d1p7ge2, d1p7ge3, d1p7gf2, d1p7gf3, d1p7gg2, d1p7gg3, d1p7gh2, d1p7gh3, d1p7gi2, d1p7gi3, d1p7gj2, d1p7gj3, d1p7gk2, d1p7gk3, d1p7gl2, d1p7gl3, d1p7gm2, d1p7gm3, d1p7gn2, d1p7gn3, d1p7go2, d1p7go3, d1p7gp2, d1p7gp3, d1p7gq2, d1p7gq3, d1p7gr2, d1p7gr3, d1p7gs2, d1p7gs3, d1p7gt2, d1p7gt3, d1p7gu2, d1p7gu3, d1p7gv2, d1p7gv3, d1p7gw2, d1p7gw3, d1p7gx2, d1p7gx3
    complexed with act, bme

Details for d1p7ge1

PDB Entry: 1p7g (more details), 1.8 Å

PDB Description: Crystal structure of superoxide dismutase from Pyrobaculum aerophilum
PDB Compounds: (E:) superoxide dismutase

SCOPe Domain Sequences for d1p7ge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7ge1 a.2.11.1 (E:13-103) Fe superoxide dismutase (FeSOD) {Pyrobaculum aerophilum [TaxId: 13773]}
vttkrytlpplpyaynalepyisaeimqlhhqkhhqgyvnganaaleklekfrkgeaqid
iravlrdlsfhlnghilhsifwpnmappgkg

SCOPe Domain Coordinates for d1p7ge1:

Click to download the PDB-style file with coordinates for d1p7ge1.
(The format of our PDB-style files is described here.)

Timeline for d1p7ge1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p7ga1, d1p7ga2, d1p7ga3, d1p7gb1, d1p7gb2, d1p7gb3, d1p7gc1, d1p7gc2, d1p7gc3, d1p7gd1, d1p7gd2, d1p7gd3, d1p7gf1, d1p7gf2, d1p7gf3, d1p7gg1, d1p7gg2, d1p7gg3, d1p7gh1, d1p7gh2, d1p7gh3, d1p7gi1, d1p7gi2, d1p7gi3, d1p7gj1, d1p7gj2, d1p7gj3, d1p7gk1, d1p7gk2, d1p7gk3, d1p7gl1, d1p7gl2, d1p7gl3, d1p7gm1, d1p7gm2, d1p7gm3, d1p7gn1, d1p7gn2, d1p7gn3, d1p7go1, d1p7go2, d1p7go3, d1p7gp1, d1p7gp2, d1p7gp3, d1p7gq1, d1p7gq2, d1p7gq3, d1p7gr1, d1p7gr2, d1p7gr3, d1p7gs1, d1p7gs2, d1p7gs3, d1p7gt1, d1p7gt2, d1p7gt3, d1p7gu1, d1p7gu2, d1p7gu3, d1p7gv1, d1p7gv2, d1p7gv3, d1p7gw1, d1p7gw2, d1p7gw3, d1p7gx1, d1p7gx2, d1p7gx3