SCOP 1.67: Domain d1p7ea_: 1p7e A:

Lineage for d1p7ea_ (1p7e A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (24 PDB entries)

8. Domain d1p7ea_: 1p7e A: [94221]

Details for d1p7ea_

PDB Entry: 1p7e

PDB Description: gb3 solution structure obtained by refinement of x-ray structure with dipolar couplings

SCOP Domain Sequences for d1p7ea_:

Sequence; same for both SEQRES and ATOM records:

>d1p7ea_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
mqyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte

Timeline for d1p7ea_:

• d1p7ea_ is new in SCOP 1.67
  
• d1p7ea_ appears in SCOP 1.69
  
• d1p7ea_ appears in the current release, SCOPe 2.08, called d1p7ea1