SCOPe 2.08: Domain d1p69b1: 1p69 B:24-146

Lineage for d1p69b1 (1p69 B:24-146)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48731] (7 PDB entries)

8. Domain d1p69b1: 1p69 B:24-146 [94160]
   Other proteins in same PDB: d1p69a_, d1p69b2
   mutant

Details for d1p69b1

PDB Entry: 1p69, 3.1 Å

PDB Description: structural basis for variation in adenovirus affinity for the cellular receptor car (p417s mutant)

PDB Compounds: (B:) coxsackievirus and adenovirus receptor

SCOPe Domain Sequences for d1p69b1:

Sequence; same for both SEQRES and ATOM records:

>d1p69b1 b.1.1.1 (B:24-146) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]}
ittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiyd
dyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlvkp
sga

Timeline for d1p69b1:

• d1p69b1 first appeared in SCOP 1.67, called d1p69b_
  
• d1p69b1 appears in SCOPe 2.07