SCOPe 2.06: Domain d1p5tb1: 1p5t B:5-108

Lineage for d1p5tb1 (1p5t B:5-108)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
   Pfam PF00640

6. Protein Docking protein 1, Dok1 [101834] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101835] (2 PDB entries)
   Uniprot P97465 152-254

8. Domain d1p5tb1: 1p5t B:5-108 [94149]
   Other proteins in same PDB: d1p5ta2, d1p5tb2

Details for d1p5tb1

PDB Entry: 1p5t, 2.35 Å

PDB Description: Crystal Structure of Dok1 PTB Domain

PDB Compounds: (B:) Docking protein 1

SCOPe Domain Sequences for d1p5tb1:

Sequence; same for both SEQRES and ATOM records:

>d1p5tb1 b.55.1.2 (B:5-108) Docking protein 1, Dok1 {Mouse (Mus musculus) [TaxId: 10090]}
gsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllrrygr
dkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqkaq

Timeline for d1p5tb1:

• d1p5tb1 first appeared in SCOP 1.67, called d1p5tb_
  
• d1p5tb1 was called d1p5tb_ in SCOPe 2.05
  
• d1p5tb1 appears in SCOPe 2.07
  
• d1p5tb1 appears in the current release, SCOPe 2.08