SCOP 1.67: Domain d1p5tb_: 1p5t B:

Lineage for d1p5tb_ (1p5t B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (8 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (8 proteins)

6. Protein Docking protein 1, Dok1 [101834] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101835] (1 PDB entry)

8. Domain d1p5tb_: 1p5t B: [94149]

Details for d1p5tb_

PDB Entry: 1p5t, 2.35 Å

PDB Description: Crystal Structure of Dok1 PTB Domain

SCOP Domain Sequences for d1p5tb_:

Sequence; same for both SEQRES and ATOM records:

>d1p5tb_ b.55.1.2 (B:) Docking protein 1, Dok1 {Mouse (Mus musculus)}
mgsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllrryg
rdkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqkaq

Timeline for d1p5tb_:

• d1p5tb_ is new in SCOP 1.67
  
• d1p5tb_ appears in SCOP 1.69
  
• d1p5tb_ appears in the current release, SCOPe 2.08, called d1p5tb1