Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Intercellular adhesion molecule-1, ICAM-1 [49162] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49163] (6 PDB entries) |
Domain d1p53b3: 1p53 B:367-450 [94123] Other proteins in same PDB: d1p53a1, d1p53b1 D3 and D5 complexed with nag, ndg |
PDB Entry: 1p53 (more details), 3.06 Å
SCOPe Domain Sequences for d1p53b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p53b3 b.1.1.4 (B:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} ygprlderdcpgnwtwpensqqtpmcqawgnplpelkclkdgtfplpigesvtvtrdleg tylcrarstqgevtrevtvnvlsp
Timeline for d1p53b3: