SCOPe 2.06: Domain d1p53b1: 1p53 B:283-366

Lineage for d1p53b1 (1p53 B:283-366)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries)

8. Domain d1p53b1: 1p53 B:283-366 [94121]
   Other proteins in same PDB: d1p53a2, d1p53a3, d1p53b2, d1p53b3
   D4; putative family assignment as the region corresponding to C and C' strands is disordered
   complexed with nag, ndg

Details for d1p53b1

PDB Entry: 1p53, 3.06 Å

PDB Description: the crystal structure of icam-1 d3-d5 fragment

PDB Compounds: (B:) intercellular adhesion molecule-1

SCOPe Domain Sequences for d1p53b1:

Sequence, based on SEQRES records:

>d1p53b1 b.1.1.3 (B:283-366) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fpapnviltkpevsegtevtvkceahprakvtlngvpaqplgpraqlllkatpedngrsf
scsatlevagqlihknqtrelrvl

Sequence, based on observed residues (ATOM records):

>d1p53b1 b.1.1.3 (B:283-366) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fpapnviltkpevsegtevtvkceagpraqlllkatpedngrsfscsatlevagqlihkn
qtrelrvl

Timeline for d1p53b1:

• d1p53b1 first appeared in SCOP 1.67
  
• d1p53b1 appears in SCOPe 2.05
  
• d1p53b1 appears in SCOPe 2.07
  
• d1p53b1 appears in the current release, SCOPe 2.08