Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.3: C2 set domains [49142] (8 proteins) |
Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries) |
Domain d1p53b1: 1p53 B:283-366 [94121] Other proteins in same PDB: d1p53a2, d1p53a3, d1p53b2, d1p53b3 D4; putative family assignment as the region corresponding to C and C' strands is disordered complexed with nag, ndg |
PDB Entry: 1p53 (more details), 3.06 Å
SCOPe Domain Sequences for d1p53b1:
Sequence, based on SEQRES records: (download)
>d1p53b1 b.1.1.3 (B:283-366) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} fpapnviltkpevsegtevtvkceahprakvtlngvpaqplgpraqlllkatpedngrsf scsatlevagqlihknqtrelrvl
>d1p53b1 b.1.1.3 (B:283-366) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} fpapnviltkpevsegtevtvkceagpraqlllkatpedngrsfscsatlevagqlihkn qtrelrvl
Timeline for d1p53b1: