SCOPe 2.08: Domain d1p4ra2: 1p4r A:201-592

Lineage for d1p4ra2 (1p4r A:201-592)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.4: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (2 proteins)
   duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs

6. Protein AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64199] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102716] (3 PDB entries)

8. Domain d1p4ra2: 1p4r A:201-592 [94114]
   Other proteins in same PDB: d1p4ra1, d1p4rb1
   complexed with 354, amz, k, xmp

Details for d1p4ra2

PDB Entry: 1p4r, 2.55 Å

PDB Description: Crystal Structure of Human ATIC in complex with folate-based inhibitor BW1540U88UD

PDB Compounds: (A:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d1p4ra2:

Sequence; same for both SEQRES and ATOM records:

>d1p4ra2 c.97.1.4 (A:201-592) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Human (Homo sapiens) [TaxId: 9606]}
vsqmplrygmnphqtpaqlytlqpklpitvlngapgfinlcdalnawqlvkelkealgip
aaasfkhvspagaavgiplsedeakvcmvydlyktltpisaayarargadrmssfgdfva
lsdvcdvptakiisrevsdgiiapgyeeealtilskkkngnycvlqmdqsykpdenevrt
lfglhlsqkrnngvvdkslfsnvvtknkdlpesalrdlivatiavkytqsnsvcyakngq
vigigagqqsrihctrlagdkanywwlrhhpqvlsmkfktgvkraeisnaidqyvtgtig
ededlikwkalfeevpellteaekkewvekltevsissdaffpfrdnvdrakrsgvayia
apsgsaadkvvieacdelgiilahtnlrlfhh

Timeline for d1p4ra2:

• d1p4ra2 first appeared in SCOP 1.67
  
• d1p4ra2 appears in SCOPe 2.07