Lineage for d1p4ld_ (1p4l D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1048063Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1048064Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1048065Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1048278Protein NK cell receptor [56452] (3 species)
  7. 1048282Species Mouse (Mus musculus), ly49-c [TaxId:10090] [103351] (3 PDB entries)
  8. 1048287Domain d1p4ld_: 1p4l D: [94109]
    Other proteins in same PDB: d1p4la1, d1p4la2, d1p4lb_
    mutant

Details for d1p4ld_

PDB Entry: 1p4l (more details), 2.9 Å

PDB Description: Crystal structure of NK receptor Ly49C mutant with its MHC class I ligand H-2Kb
PDB Compounds: (D:) ly49-c

SCOPe Domain Sequences for d1p4ld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4ld_ d.169.1.1 (D:) NK cell receptor {Mouse (Mus musculus), ly49-c [TaxId: 10090]}
rgvkywfcystkcyyfimnkttwsgckancqhygvpilkiededelkflqrhvipgnywi
glsydkkkkewawidngpskldmkikkmnfksrgcvflskariedidcnipyycicgkkl
dk

SCOPe Domain Coordinates for d1p4ld_:

Click to download the PDB-style file with coordinates for d1p4ld_.
(The format of our PDB-style files is described here.)

Timeline for d1p4ld_: