Lineage for d1p4la2 (1p4l A:2-181)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897285Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1897685Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (47 PDB entries)
    Uniprot P01901 22-299
  8. 1897752Domain d1p4la2: 1p4l A:2-181 [94107]
    Other proteins in same PDB: d1p4la1, d1p4lb_, d1p4ld_
    mutant

Details for d1p4la2

PDB Entry: 1p4l (more details), 2.9 Å

PDB Description: crystal structure of nk receptor ly49c mutant with its mhc class i ligand h-2kb
PDB Compounds: (A:) MHC class I h-2kb heavy chain

SCOPe Domain Sequences for d1p4la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4la2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
phslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeywe
retqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgc
dyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatllr

SCOPe Domain Coordinates for d1p4la2:

Click to download the PDB-style file with coordinates for d1p4la2.
(The format of our PDB-style files is described here.)

Timeline for d1p4la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p4la1