SCOP 1.67: Domain d1p4la2: 1p4l A:2-181

Lineage for d1p4la2 (1p4l A:2-181)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (34 PDB entries)

8. Domain d1p4la2: 1p4l A:2-181 [94107]
   Other proteins in same PDB: d1p4la1, d1p4lb_, d1p4ld_
   mutant

Details for d1p4la2

PDB Entry: 1p4l, 2.9 Å

PDB Description: crystal structure of nk receptor ly49c mutant with its mhc class i ligand h-2kb

SCOP Domain Sequences for d1p4la2:

Sequence; same for both SEQRES and ATOM records:

>d1p4la2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
phslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeywe
retqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgc
dyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatllr

Timeline for d1p4la2:

• d1p4la2 is new in SCOP 1.67
  
• d1p4la2 appears in SCOP 1.69
  
• d1p4la2 appears in the current release, SCOPe 2.08