Lineage for d1p48b2 (1p48 B:501-641)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411574Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 411575Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 411576Family d.54.1.1: Enolase N-terminal domain-like [54827] (9 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 411621Protein Enolase [54828] (5 species)
  7. 411622Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (14 PDB entries)
  8. 411633Domain d1p48b2: 1p48 B:501-641 [94088]
    Other proteins in same PDB: d1p48a1, d1p48b1
    complexed with mg, pep; mutant

Details for d1p48b2

PDB Entry: 1p48 (more details), 2 Å

PDB Description: reverse protonation is the key to general acid-base catalysis in enolase
PDB Compounds: (B:)

SCOP Domain Sequences for d1p48b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p48b2 d.54.1.1 (B:501-641) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOP Domain Coordinates for d1p48b2:

Click to download the PDB-style file with coordinates for d1p48b2.
(The format of our PDB-style files is described here.)

Timeline for d1p48b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p48b1