Lineage for d1p48b1 (1p48 B:642-936)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445370Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 2445371Protein Enolase [51606] (10 species)
    Fold of this protein slightly differs from common fold in topology
  7. 2445372Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (16 PDB entries)
  8. 2445393Domain d1p48b1: 1p48 B:642-936 [94087]
    Other proteins in same PDB: d1p48a2, d1p48b2
    complexed with mg, pep

Details for d1p48b1

PDB Entry: 1p48 (more details), 2 Å

PDB Description: reverse protonation is the key to general acid-base catalysis in enolase
PDB Compounds: (B:) enolase 1

SCOPe Domain Sequences for d1p48b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p48b1 c.1.11.1 (B:642-936) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkry
gasagnvgdqggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld
fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd
ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt
fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl

SCOPe Domain Coordinates for d1p48b1:

Click to download the PDB-style file with coordinates for d1p48b1.
(The format of our PDB-style files is described here.)

Timeline for d1p48b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p48b2