Lineage for d1p43b1 (1p43 B:642-936)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475826Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this family
  5. 475827Family c.1.11.1: Enolase [51605] (1 protein)
  6. 475828Protein Enolase [51606] (6 species)
    Fold of this protein slightly differs from common fold in topology
  7. 475829Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (14 PDB entries)
  8. 475833Domain d1p43b1: 1p43 B:642-936 [94074]
    Other proteins in same PDB: d1p43a2, d1p43b2

Details for d1p43b1

PDB Entry: 1p43 (more details), 1.8 Å

PDB Description: reverse protonation is the key to general acid-base catalysis in enolase

SCOP Domain Sequences for d1p43b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p43b1 c.1.11.1 (B:642-936) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
spyvlpvpflnvlnggshaggalalqqfmiaptgaktfaealrigsevyhnlksltkkry
gasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld
fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd
ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt
fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl

SCOP Domain Coordinates for d1p43b1:

Click to download the PDB-style file with coordinates for d1p43b1.
(The format of our PDB-style files is described here.)

Timeline for d1p43b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p43b2