Lineage for d1p3ka_ (1p3k A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698296Protein Histone H3 [47122] (6 species)
  7. 2698297Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (41 PDB entries)
  8. 2698334Domain d1p3ka_: 1p3k A: [94024]
    Other proteins in same PDB: d1p3kb_, d1p3kc_, d1p3kd_, d1p3kf_, d1p3kg_, d1p3kh_
    protein/DNA complex; mutant

Details for d1p3ka_

PDB Entry: 1p3k (more details), 2.9 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
PDB Compounds: (A:) histone h3

SCOPe Domain Sequences for d1p3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3ka_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
hryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeasea
ylvalfedtnlcaihakrvaimpkdiqlarrirgera

SCOPe Domain Coordinates for d1p3ka_:

Click to download the PDB-style file with coordinates for d1p3ka_.
(The format of our PDB-style files is described here.)

Timeline for d1p3ka_: