SCOPe 2.01: Domain d1p3fe_: 1p3f E:

Lineage for d1p3fe_ (1p3f E:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (5 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (38 PDB entries)

8. Domain d1p3fe_: 1p3f E: [94002]
   Other proteins in same PDB: d1p3fb_, d1p3fc_, d1p3fd_, d1p3ff_, d1p3fg_, d1p3fh_
   protein/DNA complex; mutant

Details for d1p3fe_

PDB Entry: 1p3f, 2.9 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

PDB Compounds: (E:) histone h3

SCOPe Domain Sequences for d1p3fe_:

Sequence; same for both SEQRES and ATOM records:

>d1p3fe_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
eaylvalfedtnlcaihakrvtimpkdiqlarrirgera

Timeline for d1p3fe_:

• d1p3fe_ first appeared in SCOP 1.67
  
• d1p3fe_ appears in SCOP 1.75
  
• d1p3fe_ appears in SCOPe 2.02
  
• d1p3fe_ appears in the current release, SCOPe 2.08