| Class g: Small proteins [56992] (98 folds) |
| Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) ![]() |
| Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
| Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [57365] (86 PDB entries) |
| Domain d1p2qd_: 1p2q D: [93955] Other proteins in same PDB: d1p2qa_, d1p2qc_ complexed with so4, trs |
PDB Entry: 1p2q (more details), 1.8 Å
SCOPe Domain Sequences for d1p2qd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p2qd_ g.8.1.1 (D:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpcfariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga
Timeline for d1p2qd_: